Review

human bax gene (Addgene inc)

Addgene inc is a verified supplier

About

News

Press Release

Team

Advisors

Partners

Contact

Bioz Stars

Bioz vStars

Buy from Supplier

Structured Review

Addgene inc human bax gene
Human Bax Gene, supplied by Addgene inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human bax gene/product/Addgene inc
Average 90 stars, based on 1 article reviews

human bax gene - by Bioz Stars, 2026-05

90/100 stars

Images

Image Search Results

a , Schematic for the surface IP of BCL2-family proteins. Anti-apoptotic proteins in cell extracts were immobilized onto the surface of the reaction chamber. b , Schematic of immunoassay selectively detecting protein complexes (left) and the total level of surface bait protein (right). The fluorescence signals from detection antibodies were imaged under total internal reflection (TIR) excitation. c , Comparison of the formation of model BCL2-BIM BH3 complex in an intracellular environment by BCL2-mCherry/BIM BH3 -eGFP co-expression (right) and in vitro mixing of two individual extracts with each expressing BCL2-mCherry and BIM BH3 -eGFP (left) ( n = 10 independent images). d , Changes in active BAX level measured for staurosporine-treated HL60 cells after lysis and IP with different detergent types ( n = 5 independent images). e , Single-molecule count of surface-immobilized BCL2-eGFP from the crude extract with indicated IP antibodies ( n = 10 independent images). f , Comparison of signal-to-noise ratio between single-molecule counting analysis and integration of total fluorescence signals. g , Counts of endogenous BCL2 protein complexes from the 30,000 HL60 cells by using immunoassay ( n = 3 biological replicates) (two-sided two-sample t -test, *** P = 1.5 × 10 −5 , 1.1 × 10 −5 ). h , Counts of endogenous BCL2-BIM complexes and interchip c.v.s from the fixed numbers of HL60 cells ( n = 3 biological replicates). i , Interchip c.v.s obtained from independent interchip measurement for all immunoassays and cell numbers ( n = 3 biological replicates). Data represent means ± s.d.

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a , Schematic for the surface IP of BCL2-family proteins. Anti-apoptotic proteins in cell extracts were immobilized onto the surface of the reaction chamber. b , Schematic of immunoassay selectively detecting protein complexes (left) and the total level of surface bait protein (right). The fluorescence signals from detection antibodies were imaged under total internal reflection (TIR) excitation. c , Comparison of the formation of model BCL2-BIM BH3 complex in an intracellular environment by BCL2-mCherry/BIM BH3 -eGFP co-expression (right) and in vitro mixing of two individual extracts with each expressing BCL2-mCherry and BIM BH3 -eGFP (left) ( n = 10 independent images). d , Changes in active BAX level measured for staurosporine-treated HL60 cells after lysis and IP with different detergent types ( n = 5 independent images). e , Single-molecule count of surface-immobilized BCL2-eGFP from the crude extract with indicated IP antibodies ( n = 10 independent images). f , Comparison of signal-to-noise ratio between single-molecule counting analysis and integration of total fluorescence signals. g , Counts of endogenous BCL2 protein complexes from the 30,000 HL60 cells by using immunoassay ( n = 3 biological replicates) (two-sided two-sample t -test, *** P = 1.5 × 10 −5 , 1.1 × 10 −5 ). h , Counts of endogenous BCL2-BIM complexes and interchip c.v.s from the fixed numbers of HL60 cells ( n = 3 biological replicates). i , Interchip c.v.s obtained from independent interchip measurement for all immunoassays and cell numbers ( n = 3 biological replicates). Data represent means ± s.d.

Article Snippet: All full-length BCL2-family proteins ( BCL2 (HG10195-M, SinoBiological), BCLxL (HG10455-M, SinoBiological), MCL1 (HG10240-M, SinoBiological), BIM EL (HG13816-G, SinoBiological), BAD (HG10020-M, SinoBiological), BAX (HG11619-M, SinoBiological), BAK (HG10450-M, SinoBiological) and NOXA (HG16548-U, SinoBiological)) were isolated from their respective human complementary (c)DNA. cDNA of BIM BH3 (MRQAEPADMRPEIWIAQELRRIGDEFNAYYARR) was isolated from BIM EL cDNA. cDNA of BAK fragments (residues 24–69 (α 1 helix), 70–91 (α 2 –α 3 helices), 90–150 (α 3 –α 5 helices) and 146–187 (α 6 –α 8 helices)) were isolated from BAK cDNA.

Techniques: Fluorescence, Comparison, Expressing, In Vitro, Lysis, Single Molecule Counting

a-c , Selection of monoclonal antibodies for surface immunoprecipitation (IP). Surface IP of eGFP-labeled target anti-apoptotic proteins from transfected HEK293T crude cell extracts. Crude cell extracts with 1 nM of eGFP-labeled anti-apoptotic protein were used to IP. ( a ) BCL2 IP antibody, ( b ) BCLxL IP antibody, ( c ) MCL1 IP antibody ( n = 10 independent images). d-f , Selection of monoclonal antibodies for total level immunoassay of surface-immobilized target anti-apoptotic proteins. ( d ) BCL2 detection antibody, ( e ) BCLxL detection antibody, ( f ) MCL1 detection antibody ( n = 10 independent images). g , Relative model BCL2-BIM BH3 complex from BCL2-mCherry/BIM BH3 -eGFP co-transfected HEK293T cells after the lysis with different detergent types ( n = 10 independent images). h , Detection of surface-immobilized BAK fragments by using the monoclonal antibody AT38E2. Crude cell extracts with 1 nM of eGFP-labeled BAK fragments were used to IP ( n = 10 independent images). The data were normalized to the BAK level of 24-69 (α1) fragments. i , Activation of BAK from HL60 and Ramos cells by heat or triton X-100 treatment to crude cell extracts. The data were normalized to the active BAK level of non-treated HL60. j , Schematics for the preparation of HL60 samples with different preservation conditions. k,l , Comparison of the PPI profiles across the sample states using SMPC platform. ( k ) BCL2 total level, ( l ) BCL2-BAX complex ( n = 10 independent images). Error bars represent means±s.d.

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a-c , Selection of monoclonal antibodies for surface immunoprecipitation (IP). Surface IP of eGFP-labeled target anti-apoptotic proteins from transfected HEK293T crude cell extracts. Crude cell extracts with 1 nM of eGFP-labeled anti-apoptotic protein were used to IP. ( a ) BCL2 IP antibody, ( b ) BCLxL IP antibody, ( c ) MCL1 IP antibody ( n = 10 independent images). d-f , Selection of monoclonal antibodies for total level immunoassay of surface-immobilized target anti-apoptotic proteins. ( d ) BCL2 detection antibody, ( e ) BCLxL detection antibody, ( f ) MCL1 detection antibody ( n = 10 independent images). g , Relative model BCL2-BIM BH3 complex from BCL2-mCherry/BIM BH3 -eGFP co-transfected HEK293T cells after the lysis with different detergent types ( n = 10 independent images). h , Detection of surface-immobilized BAK fragments by using the monoclonal antibody AT38E2. Crude cell extracts with 1 nM of eGFP-labeled BAK fragments were used to IP ( n = 10 independent images). The data were normalized to the BAK level of 24-69 (α1) fragments. i , Activation of BAK from HL60 and Ramos cells by heat or triton X-100 treatment to crude cell extracts. The data were normalized to the active BAK level of non-treated HL60. j , Schematics for the preparation of HL60 samples with different preservation conditions. k,l , Comparison of the PPI profiles across the sample states using SMPC platform. ( k ) BCL2 total level, ( l ) BCL2-BAX complex ( n = 10 independent images). Error bars represent means±s.d.

Techniques: Selection, Immunoprecipitation, Labeling, Transfection, Lysis, Activation Assay, Preserving, Comparison

a , Counts of BCL2-related immunoassays (BCL2-BIM complex, BCL2-BAX complex, BCL2 total level) from the fixed numbers of HL60 cells ( n = 3). b , Counts of BCLxL-related immunoassays (BCLxL-BIM complex, BCLxL-BAX complex, BCLxL-BAD complex, BCLxL-BAK complex, BCLxL total level) from the fixed numbers of PC9 cells ( n = 3). c , Counts of MCL1-related immunoassays (MCL1-BIM complex, MCL1-BAK complex, MCL1 total level) from the fixed numbers of PC9 cells ( n = 3). The single-molecule counts were rescaled to account for the labeling efficiencies of the immunoassays calculated in Extended Data Fig. as well as the specific incubation conditions for direct comparison. All data were measured from independent inter-chip experiments. CVs obtained from independent inter-chip measurement for all the immunoassays and cell numbers ( n = 3). Individual data points shown for independent biological replicates.

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a , Counts of BCL2-related immunoassays (BCL2-BIM complex, BCL2-BAX complex, BCL2 total level) from the fixed numbers of HL60 cells ( n = 3). b , Counts of BCLxL-related immunoassays (BCLxL-BIM complex, BCLxL-BAX complex, BCLxL-BAD complex, BCLxL-BAK complex, BCLxL total level) from the fixed numbers of PC9 cells ( n = 3). c , Counts of MCL1-related immunoassays (MCL1-BIM complex, MCL1-BAK complex, MCL1 total level) from the fixed numbers of PC9 cells ( n = 3). The single-molecule counts were rescaled to account for the labeling efficiencies of the immunoassays calculated in Extended Data Fig. as well as the specific incubation conditions for direct comparison. All data were measured from independent inter-chip experiments. CVs obtained from independent inter-chip measurement for all the immunoassays and cell numbers ( n = 3). Individual data points shown for independent biological replicates.

Techniques: Labeling, Incubation, Comparison

a – d , Changes in endogenous BCL2-family PPI profiles of HL60 cells through apoptosis progression by 2 μM of staurosporine. Active BAX/BAK level ( a ), total levels of anti-apoptotic proteins ( b ), BIM complexes ( c ), BAX complexes ( n = 10 independent images) ( d ). e , Schematic of the PBA to measure the unoccupied populations of surface-immobilized anti-apoptotic proteins. f , Changes in BIM BH3 PBAs for anti-apoptotic proteins from HL60 cells through apoptosis progression by staurosporine ( n = 10 independent images). g , Schematic of the comparison of the BCL2 protein complex compositions in different AML cell lines (left). The density of surface-immobilized BCL2 was constantly maintained by optimizing the total protein concentration of crude cell extracts in all AML cell lines (right) ( n = 10 independent images). h – j , Compositions of the BCL2 PPI profiles in AML cell lines. BCL2 protein complexes ( h ), BCL2-BIM BH3 PBA ( n = 10 independent images) ( i ), integrated BCL2 complex compositions ( j ). k , Changes in BCL2-BIM BH3 PBA and BCL2-BAD PBA with increasing amounts of BAD probe ( n = 10 independent images). BIM BH3 probe was presented at 10 nM. The single-molecule counts were rescaled to account for the labelling efficiencies of the immunoassays calculated in Extended Data Fig. . Data represent means ± s.d.

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a – d , Changes in endogenous BCL2-family PPI profiles of HL60 cells through apoptosis progression by 2 μM of staurosporine. Active BAX/BAK level ( a ), total levels of anti-apoptotic proteins ( b ), BIM complexes ( c ), BAX complexes ( n = 10 independent images) ( d ). e , Schematic of the PBA to measure the unoccupied populations of surface-immobilized anti-apoptotic proteins. f , Changes in BIM BH3 PBAs for anti-apoptotic proteins from HL60 cells through apoptosis progression by staurosporine ( n = 10 independent images). g , Schematic of the comparison of the BCL2 protein complex compositions in different AML cell lines (left). The density of surface-immobilized BCL2 was constantly maintained by optimizing the total protein concentration of crude cell extracts in all AML cell lines (right) ( n = 10 independent images). h – j , Compositions of the BCL2 PPI profiles in AML cell lines. BCL2 protein complexes ( h ), BCL2-BIM BH3 PBA ( n = 10 independent images) ( i ), integrated BCL2 complex compositions ( j ). k , Changes in BCL2-BIM BH3 PBA and BCL2-BAD PBA with increasing amounts of BAD probe ( n = 10 independent images). BIM BH3 probe was presented at 10 nM. The single-molecule counts were rescaled to account for the labelling efficiencies of the immunoassays calculated in Extended Data Fig. . Data represent means ± s.d.

Techniques: Comparison, Protein Concentration

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a – e , Changes in BCL2-family PPI profiles in HL60 cells after ABT-199 treatment (100 nM, 24 h). Total levels of anti-apoptotic proteins ( a ), active BAX/BAK level ( b ), total levels of BAX/BAK ( c ), BCL2 complexes ( d ), BCL2-BIM BH3 PBA ( n = 10 independent images) ( e ). f – h , Changes in BCL2-family PPI profile in HL60 cells after higher concentration of ABT-199 treatment (300 nM, 4 h). BCL2 complexes ( f ), active BAX/BAK level ( g ), total levels of BAX/BAK ( n = 10 independent images) ( h ). i , Schematic illustration of the mode of action of ABT-199. j – n , Changes in BCL2-family PPI profiles in U937 cells after AZD-5991 treatment (100 nM, 24 h). Active BAX/BAK level ( j ), MCL1 complexes ( k ), MCL1-BIM BH3 PBA ( l ), BCLxL complexes ( n = 10 independent images) ( m ), comparison of relative changes in BAK complexes after AZD-5991 treatment ( n ). The relative changes were obtained from the data indicated in k and m normalized to BCLxL- or MCL1-total level. o , Schematic illustration of the mode of action of AZD-5991. The single-molecule counts were rescaled to account for the labelling efficiencies of the immunoassays calculated in Extended Data Fig. ( d , k , m ). Data represent means ± s.d.

Techniques: Concentration Assay, Comparison

a , Schematic for generating linear regression correlation between ex vivo efficacy of ABT-199 and PPI profiles from primary AML samples. The collected AML cells were cultured and treated with 0–1 μM of ABT-199, and the AUCs of cell viability were obtained as ex vivo drug efficacy (top). Approximately 1.2 × 10 6 of primary AML cells on the same cohort underwent PPI profiling with the SMPC (bottom). b , The absolute Pearson correlations between ex vivo AUC of ABT-199 and PPI metrics for primary AML samples (one-sided F -test, * P < 0.05, ** P < 0.01, *** P < 0.001, NS, not significant; P values are provided as ) ( n = 32). c , d , Correlations between ex vivo AUC and single BCL2-related PPI metrics. BCL2-BAX CPX (coefficient: 0.157, P = 6.7 × 10 −8 ) ( c ), BCL2-BIM CPX (coefficient: 0.013, P = 0.01) (one-sided F -test) ( d ). e , Lasso coefficients of PPI profiles correlated with ex vivo AUC of ABT-199 for primary AML samples (67 models). f , Correlation between ex vivo AUC and the combination of multiple PPI metrics (BCL2-BIM BH3 PBA, BCL2-BAX CPX and BCLxL-BAK CPX) (one-sided F -test, P = 1.2 × 10 −10 ). g , ROC curve between the estimated score and the ex vivo efficacy (two-sided t -test, P = 2.9 × 10 −5 ). h , Clinical features and the ABT-199 administration history of BC-7064. i , Comparison of the PPI profiles and the estimated scores with PPI diagnostic results from the initial and the relapsed BC-7064 samples (R, responsive; NR, non-responsive) ( n = 10 independent images). Data represent means ± s.d.

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a , Schematic for generating linear regression correlation between ex vivo efficacy of ABT-199 and PPI profiles from primary AML samples. The collected AML cells were cultured and treated with 0–1 μM of ABT-199, and the AUCs of cell viability were obtained as ex vivo drug efficacy (top). Approximately 1.2 × 10 6 of primary AML cells on the same cohort underwent PPI profiling with the SMPC (bottom). b , The absolute Pearson correlations between ex vivo AUC of ABT-199 and PPI metrics for primary AML samples (one-sided F -test, * P < 0.05, ** P < 0.01, *** P < 0.001, NS, not significant; P values are provided as ) ( n = 32). c , d , Correlations between ex vivo AUC and single BCL2-related PPI metrics. BCL2-BAX CPX (coefficient: 0.157, P = 6.7 × 10 −8 ) ( c ), BCL2-BIM CPX (coefficient: 0.013, P = 0.01) (one-sided F -test) ( d ). e , Lasso coefficients of PPI profiles correlated with ex vivo AUC of ABT-199 for primary AML samples (67 models). f , Correlation between ex vivo AUC and the combination of multiple PPI metrics (BCL2-BIM BH3 PBA, BCL2-BAX CPX and BCLxL-BAK CPX) (one-sided F -test, P = 1.2 × 10 −10 ). g , ROC curve between the estimated score and the ex vivo efficacy (two-sided t -test, P = 2.9 × 10 −5 ). h , Clinical features and the ABT-199 administration history of BC-7064. i , Comparison of the PPI profiles and the estimated scores with PPI diagnostic results from the initial and the relapsed BC-7064 samples (R, responsive; NR, non-responsive) ( n = 10 independent images). Data represent means ± s.d.

Techniques: Ex Vivo, Cell Culture, Comparison, Diagnostic Assay

a , Comparison of BCL2 family PPI profiles from the healthy donor PBMC sample and HL60 cells with SMPC ( n = 10 independent images). The data were normalized to the HL60 cell. b , Correlation between ex vivo AUC for ABT-199 and combination of BCL2-related metrics (BCL2 total level, BCL2-BIM BH3 PBA, BCL2-BAD PBA, and BCL2-BAX CPX) (One-sided F -test, p -value = 1.3e-10). c , Linear correlations between two different BCL2 PBA metrics. d , Correlations between ex vivo AUC and IC 50 of primary AML samples for ABT-199 ( n = 32). e , Schematic of Lasso regression analysis for the selection of PPI metrics highly correlated with drug response. The training and test groups were randomly selected from the primary AML sample cohort. The Lasso regression models were generated using the training group and evaluated based on Pearson’s R as well as prediction outcomes for the test group. 67 models were selected from 10,000 different initial models. f , Identification of outliers in the ABT-199 drug efficacy prediction models. The residuals of each outlier in the model ( ex vivo AUC – estimated score) were indicated. g , Correlations between ex vivo AUC and IC 50 of primary AML samples for AZD-5991 ( n = 27). h , Correlation between ex vivo AUC for AZD-5991 and combination of MCL1-related metrics (MCL1 total level, MCL1-BIM BH3 PBA, MCL1-NOXA PBA, and MCL1-BAK CPX) (One-sided F -test, p -value = 2.5e-5).

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a , Comparison of BCL2 family PPI profiles from the healthy donor PBMC sample and HL60 cells with SMPC ( n = 10 independent images). The data were normalized to the HL60 cell. b , Correlation between ex vivo AUC for ABT-199 and combination of BCL2-related metrics (BCL2 total level, BCL2-BIM BH3 PBA, BCL2-BAD PBA, and BCL2-BAX CPX) (One-sided F -test, p -value = 1.3e-10). c , Linear correlations between two different BCL2 PBA metrics. d , Correlations between ex vivo AUC and IC 50 of primary AML samples for ABT-199 ( n = 32). e , Schematic of Lasso regression analysis for the selection of PPI metrics highly correlated with drug response. The training and test groups were randomly selected from the primary AML sample cohort. The Lasso regression models were generated using the training group and evaluated based on Pearson’s R as well as prediction outcomes for the test group. 67 models were selected from 10,000 different initial models. f , Identification of outliers in the ABT-199 drug efficacy prediction models. The residuals of each outlier in the model ( ex vivo AUC – estimated score) were indicated. g , Correlations between ex vivo AUC and IC 50 of primary AML samples for AZD-5991 ( n = 27). h , Correlation between ex vivo AUC for AZD-5991 and combination of MCL1-related metrics (MCL1 total level, MCL1-BIM BH3 PBA, MCL1-NOXA PBA, and MCL1-BAK CPX) (One-sided F -test, p -value = 2.5e-5).

Techniques: Comparison, Ex Vivo, Selection, Generated

a , Schematic for BH3 profiling based on JC-1 staining, and measurement of BCL2 levels using flow cytometry or western blotting for primary AML samples. b,c , BH3 profiling on HL60 cells. ( b ) Relative fluorescence units (RFU) of 590 nm wavelength for HL60 cells through the treatment of BH3 peptides or BH3 mimetics, ( c ) Depolarization of HL60 cells through the BH3 profiling. Depolarization by 10 μM of BAD peptides was indicated. d,e , Correlations for ex vivo ABT-199 AUC with ( d ) depolarizations by BAD (10 μM) – HRK (10 μM) peptides, ( e ) combination of multiple PPI metrics (BCL2-BIM BH3 PBA, BCL2-BAX CPX, and BCLxL-BAK CPX). The outliers identified in model ( d ) were indicated ( n = 14) (One-sided F -test, p -value = 0.011, 8.1e-05). f,g , ROC curves for ex vivo ABT-199 responses with ( f ) depolarizations by BAD (10 μM) – HRK (10 μM) peptides, ( g ) Combination of multiple PPI metrics (Two-sided t -test, p -value = 0.07, 0.009). h , Correlations between BCL2 protein levels determined by SMPC and flow cytometry for primary AML samples (n = 14 ). i , Prediction models for ABT-199 ex vivo AUC with BCL2 protein levels determined by flow cytometry (One-sided F -test, p -value = 0.077). j , Correlations between BCL2 protein levels determined by SMPC and western blotting for primary AML samples ( n = 32). The raw blot image is provided as a Source Data. k , Prediction models for ABT-199 ex vivo AUC with BCL2 protein levels determined by western blotting (One-sided F -test, p -value = 0.0003).

Journal: Nature Biomedical Engineering

Article Title: Profiling protein–protein interactions to predict the efficacy of B-cell-lymphoma-2-homology-3 mimetics for acute myeloid leukaemia

doi: 10.1038/s41551-024-01241-3

Figure Lengend Snippet: a , Schematic for BH3 profiling based on JC-1 staining, and measurement of BCL2 levels using flow cytometry or western blotting for primary AML samples. b,c , BH3 profiling on HL60 cells. ( b ) Relative fluorescence units (RFU) of 590 nm wavelength for HL60 cells through the treatment of BH3 peptides or BH3 mimetics, ( c ) Depolarization of HL60 cells through the BH3 profiling. Depolarization by 10 μM of BAD peptides was indicated. d,e , Correlations for ex vivo ABT-199 AUC with ( d ) depolarizations by BAD (10 μM) – HRK (10 μM) peptides, ( e ) combination of multiple PPI metrics (BCL2-BIM BH3 PBA, BCL2-BAX CPX, and BCLxL-BAK CPX). The outliers identified in model ( d ) were indicated ( n = 14) (One-sided F -test, p -value = 0.011, 8.1e-05). f,g , ROC curves for ex vivo ABT-199 responses with ( f ) depolarizations by BAD (10 μM) – HRK (10 μM) peptides, ( g ) Combination of multiple PPI metrics (Two-sided t -test, p -value = 0.07, 0.009). h , Correlations between BCL2 protein levels determined by SMPC and flow cytometry for primary AML samples (n = 14 ). i , Prediction models for ABT-199 ex vivo AUC with BCL2 protein levels determined by flow cytometry (One-sided F -test, p -value = 0.077). j , Correlations between BCL2 protein levels determined by SMPC and western blotting for primary AML samples ( n = 32). The raw blot image is provided as a Source Data. k , Prediction models for ABT-199 ex vivo AUC with BCL2 protein levels determined by western blotting (One-sided F -test, p -value = 0.0003).

Techniques: Staining, Flow Cytometry, Western Blot, Fluorescence, Ex Vivo

Review

Structured Review

Images

Similar Products

Image Search Results